PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00521g00814.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 85aa    MW: 9451.49 Da    PI: 4.4635
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00521g00814.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.21.4e-113979446
                              S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              +++eE++l+++  ++ G + W++Ia +++ gR+++++  +w++
  Peaxi162Scf00521g00814.1 39 FSEEEEDLIIRMYNLVGER-WSLIAGRIP-GRSAEEIEKYWNT 79
                              89*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.1543185IPR017930Myb domain
SMARTSM007176.7E-93583IPR001005SANT/Myb domain
SuperFamilySSF466892.81E-93980IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-153979IPR009057Homeodomain-like
PfamPF002496.3E-113979IPR001005SANT/Myb domain
CDDcd001679.35E-74579No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MADKGQSSSS VNTPADSQDV VAPRMLVSGK TSKVAEIEFS EEEEDLIIRM YNLVGERWSL  60
IAGRIPGRSA EEIEKYWNTR SSTSQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9850221e-133KF985022.1 Petunia x hybrida cultivar Mitchell R3-MYB anthocyanin repressor (MYBx) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607344.12e-33PREDICTED: MYB-like transcription factor ETC1
RefseqXP_016481564.12e-33PREDICTED: MYB-like transcription factor ETC1
TrEMBLA0A023PIT62e-54A0A023PIT6_PETHY; R3-MYB anthocyanin repressor
STRINGPOPTR_0004s02060.18e-27(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA65791932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01380.13e-17MYB_related family protein